Lineage for d5z0bb3 (5z0b B:389-584)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730255Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2730256Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. 2730388Domain d5z0bb3: 5z0b B:389-584 [361585]
    automated match to d1n5ua3
    complexed with 1pe, eic, oca, peg, pg4, pge, plm, so4, trp

Details for d5z0bb3

PDB Entry: 5z0b (more details), 2.17 Å

PDB Description: crystal structure of plasma-derived human serum albumin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5z0bb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0bb3 a.126.1.1 (B:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOPe Domain Coordinates for d5z0bb3:

Click to download the PDB-style file with coordinates for d5z0bb3.
(The format of our PDB-style files is described here.)

Timeline for d5z0bb3: