Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins) |
Protein automated matches [226957] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [361564] (1 PDB entry) |
Domain d5zz9a_: 5zz9 A: [361573] automated match to d2p8va_ |
PDB Entry: 5zz9 (more details), 2.3 Å
SCOPe Domain Sequences for d5zz9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zz9a_ b.55.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} geqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinsti tpnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarlard
Timeline for d5zz9a_: