| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
| Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
| Protein Barnase [81305] (1 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
| Domain d1bscb_: 1bsc B: [36155] mutant |
PDB Entry: 1bsc (more details), 2 Å
SCOPe Domain Sequences for d1bscb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bscb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrvlyssdwliykttdhyqtftkir
Timeline for d1bscb_: