Lineage for d1brhc_ (1brh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923796Protein Barnase [81305] (1 species)
  7. 2923797Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2923819Domain d1brhc_: 1brh C: [36153]
    complexed with zn; mutant

Details for d1brhc_

PDB Entry: 1brh (more details), 2 Å

PDB Description: barnase mutant with leu 14 replaced by ala
PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1brhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brhc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadyaqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1brhc_:

Click to download the PDB-style file with coordinates for d1brhc_.
(The format of our PDB-style files is described here.)

Timeline for d1brhc_: