Lineage for d5qiib_ (5qii B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427753Protein automated matches [190085] (51 species)
    not a true protein
  7. 2427987Species Human (Homo sapiens) [TaxId:9606] [186828] (31 PDB entries)
  8. 3061465Domain d5qiib_: 5qii B: [361527]
    Other proteins in same PDB: d5qiid2
    automated match to d3dwfc1
    complexed with hjg, nap; mutant

Details for d5qiib_

PDB Entry: 5qii (more details), 2.45 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-(3-(1-(4-chlorophenyl)cyclopropyl) -[1,2, 4]triazolo[4,3-a]pyridin-8-yl)propan-2-ol
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5qiib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qiib_ c.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwt
tllirnpcrkileelystsynmdrf

SCOPe Domain Coordinates for d5qiib_:

Click to download the PDB-style file with coordinates for d5qiib_.
(The format of our PDB-style files is described here.)

Timeline for d5qiib_:

  • d5qiib_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20