SCOP 1.73: Domain d1brhb_: 1brh B:

Lineage for d1brhb_ (1brh B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d1brhb_: 1brh B: [36152]

Details for d1brhb_

PDB Entry: 1brh, 2 Å

PDB Description: barnase mutant with leu 14 replaced by ala

PDB Compounds: (B:) barnase

SCOP Domain Sequences for d1brhb_:

Sequence; same for both SEQRES and ATOM records:

>d1brhb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadyaqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1brhb_:

• d1brhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1brhb_ appears in SCOP 1.71
  
• d1brhb_ appears in SCOP 1.75
  
• d1brhb_ appears in the current release, SCOPe 2.08