SCOPe 2.05: Domain d1brkc_: 1brk C:

Lineage for d1brkc_ (1brk C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d1brkc_: 1brk C: [36150]
   complexed with zn; mutant

Details for d1brkc_

PDB Entry: 1brk, 2 Å

PDB Description: barnase mutant with ile 96 replaced by ala

PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1brkc_:

Sequence; same for both SEQRES and ATOM records:

>d1brkc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir

Timeline for d1brkc_:

• d1brkc_ first appeared (with stable ids) in SCOP 1.55
  
• d1brkc_ appears in SCOPe 2.04
  
• d1brkc_ appears in SCOPe 2.06
  
• d1brkc_ appears in the current release, SCOPe 2.08