SCOPe 2.08: Domain d6h6yh1: 6h6y H:6-118

Lineage for d6h6yh1 (6h6y H:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d6h6yh1: 6h6y H:6-118 [361491]
   Other proteins in same PDB: d6h6ye2, d6h6yf2, d6h6yg2, d6h6yh2
   automated match to d1mqkh_
   complexed with cl, edo, na

Details for d6h6yh1

PDB Entry: 6h6y, 1.58 Å

PDB Description: gi.1 human norovirus protruding domain in complex with nano-7

PDB Compounds: (H:) Nanobody (VHH) Nano-7

SCOPe Domain Sequences for d6h6yh1:

Sequence; same for both SEQRES and ATOM records:

>d6h6yh1 b.1.1.1 (H:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscavsgrtfsnyysgwfrqapgkereflasirwsdsttnyadsvk
grftisrdtakntvylqmnslkledtavyhcaarrlatydywgqgtqvtvssg

Timeline for d6h6yh1:

• d6h6yh1 first appeared in SCOPe 2.07