Lineage for d1bric_ (1bri C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28527Protein Barnase/Binase [53944] (2 species)
  7. 28528Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)
  8. 28545Domain d1bric_: 1bri C: [36147]

Details for d1bric_

PDB Entry: 1bri (more details), 1.9 Å

PDB Description: barnase mutant with ile 76 replaced by ala

SCOP Domain Sequences for d1bric_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bric_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadanytsgfrnsdrilyssdwliykttdhyqtftkir

SCOP Domain Coordinates for d1bric_:

Click to download the PDB-style file with coordinates for d1bric_.
(The format of our PDB-style files is described here.)

Timeline for d1bric_: