![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
![]() | Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
![]() | Species Human adenovirus b serotype 3 [TaxId:45659] [274530] (2 PDB entries) |
![]() | Domain d6f6oa_: 6f6o A: [361458] automated match to d3cnca_ mutant |
PDB Entry: 6f6o (more details), 1.49 Å
SCOPe Domain Sequences for d6f6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f6oa_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus b serotype 3 [TaxId: 45659]} nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv sinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfdlpnagthnen yifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitsp ftfsyiredd
Timeline for d6f6oa_: