Lineage for d6i4ba1 (6i4b A:158-567)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436558Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2436657Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141759] (3 PDB entries)
    Uniprot Q08210 158-566
    homolog, mitochonrial
  8. 2436661Domain d6i4ba1: 6i4b A:158-567 [361445]
    Other proteins in same PDB: d6i4ba2, d6i4bb2
    automated match to d1tv5a1
    complexed with e2n, fmn, oro

Details for d6i4ba1

PDB Entry: 6i4b (more details), 1.98 Å

PDB Description: plasmodium falciparum dihydroorotate dehydrogenase (dhodh) co- crystallized with 3-hydroxy-1-methyl-5-((3-(trifluoromethyl)phenoxy) methyl)-1h-pyrazole-4-carboxylic acid
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d6i4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4ba1 c.1.4.1 (A:158-567) Dihydroorotate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
yiainvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvf
vklapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistk
ficemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikreln
hllyqrgyynlkeaigrkhs

SCOPe Domain Coordinates for d6i4ba1:

Click to download the PDB-style file with coordinates for d6i4ba1.
(The format of our PDB-style files is described here.)

Timeline for d6i4ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i4ba2