![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
![]() | Domain d6ibea1: 6ibe A:107-190 [361442] Other proteins in same PDB: d6ibea2, d6ibea3 automated match to d2he7a1 complexed with edo, mes |
PDB Entry: 6ibe (more details), 1.45 Å
SCOPe Domain Sequences for d6ibea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ibea1 d.15.1.0 (A:107-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} pksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwld pakeikkqvrsgawhfsfnvkfyp
Timeline for d6ibea1: