Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein (Apo)ferritin [47246] (8 species) |
Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (81 PDB entries) |
Domain d6hjua_: 6hju A: [361440] automated match to d1iera_ complexed with cd, cl, dms, gol, pt, so4 |
PDB Entry: 6hju (more details), 1.58 Å
SCOPe Domain Sequences for d6hjua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hjua_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]} ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk
Timeline for d6hjua_: