SCOP 1.75: Domain d1brnm_: 1brn M:

Lineage for d1brnm_ (1brn M:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d1brnm_: 1brn M: [36144]

Details for d1brnm_

PDB Entry: 1brn, 1.76 Å

PDB Description: subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution

PDB Compounds: (M:) protein (barnase (e.c.3.1.27.-))

SCOP Domain Sequences for d1brnm_:

Sequence; same for both SEQRES and ATOM records:

>d1brnm_ d.1.1.2 (M:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1brnm_:

• d1brnm_ first appeared (with stable ids) in SCOP 1.55
  
• d1brnm_ appears in SCOP 1.73
  
• d1brnm_ appears in SCOPe 2.01
  
• d1brnm_ appears in the current release, SCOPe 2.08