Lineage for d1brnm_ (1brn M:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
single helix packs against antiparallel beta-sheetSuperfamily d.1.1: Microbial ribonucleases [53933] (4 families) 
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) 
Protein Barnase [81305] (1 species) Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) 
Domain d1brnm_: 1brn M: [36144]
protein/DNA complex; protein/RNA complex
Details for d1brnm_
PDB Entry: 1brn (more details), 1.76 Å
PDB Description: subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution
PDB Compounds: (M:) protein (barnase (e.c.3.1.27.-))SCOPe Domain Sequences for d1brnm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brnm_ d.1.1.2 (M:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
SCOPe Domain Coordinates for d1brnm_:
Click to download the PDB-style file with coordinates for d1brnm_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1brnm_:
- d1brnm_ first appeared (with stable ids) in SCOP 1.55
- d1brnm_ appears in SCOPe 2.07
View in 3D
