![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein automated matches [190099] (33 species) not a true protein |
![]() | Species Triticum aestivum [TaxId:4565] [361430] (1 PDB entry) |
![]() | Domain d6gera_: 6ger A: [361431] automated match to d1b1ya_ |
PDB Entry: 6ger (more details), 2 Å
SCOPe Domain Sequences for d6gera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gera_ c.1.8.1 (A:) automated matches {Triticum aestivum [TaxId: 4565]} gnmlanyvqvyvmlpldvvsvdnkfekgdeiraqlkklteagvdgvmidvwwglvegkgp kaydwsaykqvfdlvheaglklqaimsfhqcggnvgdvvnipipqwvrdvgatdpdifyt nrggtrnieyltlgvddqplfhgrtavqmyadymasfrenmkkfldagtivdievglgpa gemrypsypqsqgwvfpgigeficydkyleadfkaaaakaghpewelpddageyndtpek tqffkdngtyltekgkfflswysnklikhgdkildeankvflgcrvqlaikisgihwwyr vpnhaaeltagyynlddrdgyrtiarmltrhhasmnftcaemrdseqseeaksapeelvq qvlsagwreglhvacenalgrydatayntilrnarpkginkngppehklfgftylrlsne llegqnyatfqtfvekmhanlghdpsvdpvaplerskpempiemilkaaqpklepfpfdk ntdlpvkd
Timeline for d6gera_: