SCOPe 2.07: Domain d1brnl_: 1brn L:

Lineage for d1brnl_ (1brn L:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d1brnl_: 1brn L: [36143]
   protein/DNA complex; protein/RNA complex

Details for d1brnl_

PDB Entry: 1brn, 1.76 Å

PDB Description: subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution

PDB Compounds: (L:) protein (barnase (e.c.3.1.27.-))

SCOPe Domain Sequences for d1brnl_:

Sequence; same for both SEQRES and ATOM records:

>d1brnl_ d.1.1.2 (L:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1brnl_:

• d1brnl_ first appeared (with stable ids) in SCOP 1.55
  
• d1brnl_ appears in SCOPe 2.06
  
• d1brnl_ appears in the current release, SCOPe 2.08