Lineage for d1brnl_ (1brn L:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein Barnase/Binase [53944] (2 species) Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries) 
Domain d1brnl_: 1brn L: [36143]
Details for d1brnl_
PDB Entry: 1brn (more details), 1.76 Å
PDB Description: subsite binding in an rnase: structure of a barnase-tetranucleotide complex at 1.76 angstroms resolution
SCOP Domain Sequences for d1brnl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brnl_ d.1.1.1 (L:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
SCOP Domain Coordinates for d1brnl_:
Click to download the PDB-style file with coordinates for d1brnl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1brnl_:
- d1brnl_ appears in SCOP 1.57
- d1brnl_ appears in the current release, SCOPe 2.08
View in 3D
