SCOPe 2.08: Domain d6f7cc1: 6f7c C:1-245

Lineage for d6f7cc1 (6f7c C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6f7cc1: 6f7c C:1-245 [361428]
   Other proteins in same PDB: d6f7ca2, d6f7cb2, d6f7cc2, d6f7cd2, d6f7ce_, d6f7cf1, d6f7cf2
   automated match to d5fnva1
   complexed with acp, ca, cvt, gdp, gtp, mes, mg

Details for d6f7cc1

PDB Entry: 6f7c, 2 Å

PDB Description: tubulin-compound 12 complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6f7cc1:

Sequence; same for both SEQRES and ATOM records:

>d6f7cc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6f7cc1:

• d6f7cc1 first appeared in SCOPe 2.07