Lineage for d1a2pc_ (1a2p C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1886642Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1886643Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 1886644Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1886645Protein Barnase [81305] (1 species)
  7. 1886646Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 1886651Domain d1a2pc_: 1a2p C: [36142]
    complexed with zn

Details for d1a2pc_

PDB Entry: 1a2p (more details), 1.5 Å

PDB Description: barnase wildtype structure at 1.5 angstroms resolution
PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1a2pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2pc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1a2pc_:

Click to download the PDB-style file with coordinates for d1a2pc_.
(The format of our PDB-style files is described here.)

Timeline for d1a2pc_: