SCOPe 2.07: Domain d6bhwc1: 6bhw C:1-105

Lineage for d6bhwc1 (6bhw C:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [361346] (1 PDB entry)

8. Domain d6bhwc1: 6bhw C:1-105 [361402]
   Other proteins in same PDB: d6bhwa2, d6bhwb2, d6bhwc2, d6bhwd2, d6bhwe2, d6bhwf2, d6bhwh2
   automated match to d2vw9a_
   complexed with edo, peg

Details for d6bhwc1

PDB Entry: 6bhw, 2.21 Å

PDB Description: b. subtilis ssba

PDB Compounds: (C:) Single-stranded DNA-binding protein A

SCOPe Domain Sequences for d6bhwc1:

Sequence, based on SEQRES records:

>d6bhwc1 b.40.4.0 (C:1-105) automated matches {Bacillus subtilis [TaxId: 224308]}
mlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrqaen
vanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflep

Sequence, based on observed residues (ATOM records):

>d6bhwc1 b.40.4.0 (C:1-105) automated matches {Bacillus subtilis [TaxId: 224308]}
mlnrvvlvgrltkdpelrytpngaavatftlavnrtereadfincvtwrrqaenvanflk
kgslagvdgrlqtrnyenqqgqrvfvtevqaesvqflep

Timeline for d6bhwc1:

• d6bhwc1 is new in SCOPe 2.07-stable
  
• d6bhwc1 appears in the current release, SCOPe 2.08