Lineage for d6fpim_ (6fpi M:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. Protein automated matches [191173] (15 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [330666] (14 PDB entries)
  8. Domain d6fpim_: 6fpi M: [361395]
    Other proteins in same PDB: d6fpis_, d6fpit_
    automated match to d5lmml_
    complexed with cl, ej2, f3s, lmt, mg, sf3, sf4, so4

Details for d6fpim_

PDB Entry: 6fpi (more details), 1.5 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1) variant e28q
PDB Compounds: (M:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d6fpim_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpim_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 83333]}
stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d6fpim_ are not available.

Timeline for d6fpim_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fpil_, d6fpis_, d6fpit_