Lineage for d6fpjb_ (6fpj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913193Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries)
  8. 2913195Domain d6fpjb_: 6fpj B: [361394]
    automated match to d3o21a_
    complexed with dms, gol, nag, po4

Details for d6fpjb_

PDB Entry: 6fpj (more details), 1.96 Å

PDB Description: structure of the ampar glua3 n-terminal domain bound to phosphate
PDB Compounds: (B:) Glutamate receptor 3

SCOPe Domain Sequences for d6fpjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpjb_ c.93.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
dvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemk
vsgsrkagywneyerfvpf

SCOPe Domain Coordinates for d6fpjb_:

Click to download the PDB-style file with coordinates for d6fpjb_.
(The format of our PDB-style files is described here.)

Timeline for d6fpjb_: