Lineage for d1rtu__ (1rtu -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 76061Protein RNase U2 [53942] (1 species)
  7. 76062Species Ustilago sphaerogena [TaxId:5271] [53943] (1 PDB entry)
  8. 76063Domain d1rtu__: 1rtu - [36139]

Details for d1rtu__

PDB Entry: 1rtu (more details), 1.8 Å

PDB Description: ustilago sphaerogena ribonuclease u2

SCOP Domain Sequences for d1rtu__:

Sequence, based on SEQRES records: (download)

>d1rtu__ d.1.1.1 (-) RNase U2 {Ustilago sphaerogena}
cdipqstncggnvysnddintaiqgalddvangdrpdnyphqyyxeaseditlccgsgpw
sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

Sequence, based on observed residues (ATOM records): (download)

>d1rtu__ d.1.1.1 (-) RNase U2 {Ustilago sphaerogena}
cdipqstncggnvysnddintaiqgalddvangdrpdnyphqyyeaseditlccgsgpws
efplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

SCOP Domain Coordinates for d1rtu__:

Click to download the PDB-style file with coordinates for d1rtu__.
(The format of our PDB-style files is described here.)

Timeline for d1rtu__: