Lineage for d6bhwb1 (6bhw B:1-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790434Species Bacillus subtilis [TaxId:224308] [361346] (1 PDB entry)
  8. 2790436Domain d6bhwb1: 6bhw B:1-104 [361372]
    Other proteins in same PDB: d6bhwa2, d6bhwb2, d6bhwc2, d6bhwd2, d6bhwe2, d6bhwf2, d6bhwh2
    automated match to d2vw9a_
    complexed with edo, peg

Details for d6bhwb1

PDB Entry: 6bhw (more details), 2.21 Å

PDB Description: b. subtilis ssba
PDB Compounds: (B:) Single-stranded DNA-binding protein A

SCOPe Domain Sequences for d6bhwb1:

Sequence, based on SEQRES records: (download)

>d6bhwb1 b.40.4.0 (B:1-104) automated matches {Bacillus subtilis [TaxId: 224308]}
mlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrqaen
vanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle

Sequence, based on observed residues (ATOM records): (download)

>d6bhwb1 b.40.4.0 (B:1-104) automated matches {Bacillus subtilis [TaxId: 224308]}
mlnrvvlvgrltkdpelrytpngaavatftlavnrtgereadfincvtwrrqaenvanfl
kkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle

SCOPe Domain Coordinates for d6bhwb1:

Click to download the PDB-style file with coordinates for d6bhwb1.
(The format of our PDB-style files is described here.)

Timeline for d6bhwb1: