Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [361346] (1 PDB entry) |
Domain d6bhwb1: 6bhw B:1-104 [361372] Other proteins in same PDB: d6bhwa2, d6bhwb2, d6bhwc2, d6bhwd2, d6bhwe2, d6bhwf2, d6bhwh2 automated match to d2vw9a_ complexed with edo, peg |
PDB Entry: 6bhw (more details), 2.21 Å
SCOPe Domain Sequences for d6bhwb1:
Sequence, based on SEQRES records: (download)
>d6bhwb1 b.40.4.0 (B:1-104) automated matches {Bacillus subtilis [TaxId: 224308]} mlnrvvlvgrltkdpelrytpngaavatftlavnrtftnqsgereadfincvtwrrqaen vanflkkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle
>d6bhwb1 b.40.4.0 (B:1-104) automated matches {Bacillus subtilis [TaxId: 224308]} mlnrvvlvgrltkdpelrytpngaavatftlavnrtgereadfincvtwrrqaenvanfl kkgslagvdgrlqtrnyenqqgqrvfvtevqaesvqfle
Timeline for d6bhwb1: