SCOPe 2.08: Domain d6b6zc1: 6b6z C:6-108

Lineage for d6b6zc1 (6b6z C:6-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6b6zc1: 6b6z C:6-108 [361365]
   Other proteins in same PDB: d6b6za2, d6b6zb_, d6b6zc2, d6b6zd_
   automated match to d3pgfl1
   complexed with zn

Details for d6b6zc1

PDB Entry: 6b6z, 2.11 Å

PDB Description: crystal structure of the apo antibody fragment (fab) raised against c- terminal domain of ebola nucleoprotein (ebov, tafv, bdbv strains)

PDB Compounds: (C:) Apo Fab Light Chain

SCOPe Domain Sequences for d6b6zc1:

Sequence, based on SEQRES records:

>d6b6zc1 b.1.1.0 (C:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsg
srsgtdftltisslqpedfatyycqqysyslvtfgqgtkveik

Sequence, based on observed residues (ATOM records):

>d6b6zc1 b.1.1.0 (C:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysrfsgsrsgtdftlt
isslqpedfatyycqqysyslvtfgqgtkveik

Timeline for d6b6zc1:

• d6b6zc1 first appeared in SCOPe 2.07