Lineage for d6b6zc1 (6b6z C:6-108)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6b6zc1: 6b6z C:6-108 [361365]
    Other proteins in same PDB: d6b6za2, d6b6zb_, d6b6zc2, d6b6zd_
    automated match to d3pgfl1
    complexed with zn

Details for d6b6zc1

PDB Entry: 6b6z (more details), 2.11 Å

PDB Description: crystal structure of the apo antibody fragment (fab) raised against c- terminal domain of ebola nucleoprotein (ebov, tafv, bdbv strains)
PDB Compounds: (C:) Apo Fab Light Chain

SCOPe Domain Sequences for d6b6zc1:

Sequence, based on SEQRES records: (download)

>d6b6zc1 b.1.1.0 (C:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsg
srsgtdftltisslqpedfatyycqqysyslvtfgqgtkveik

Sequence, based on observed residues (ATOM records): (download)

>d6b6zc1 b.1.1.0 (C:6-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysrfsgsrsgtdftlt
isslqpedfatyycqqysyslvtfgqgtkveik

SCOPe Domain Coordinates for d6b6zc1 are not available.

Timeline for d6b6zc1:

Domains from same chain:
(mouse over for more information)
d6b6zc2
Domains from other chains:
(mouse over for more information)
d6b6za1, d6b6za2, d6b6zb_, d6b6zd_