Lineage for d5rnt__ (5rnt -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries) 
Domain d5rnt__: 5rnt - [36136]
Details for d5rnt__
PDB Entry: 5rnt (more details), 3.2 Å
PDB Description: x-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
SCOP Domain Sequences for d5rnt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rnt__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d5rnt__:
Click to download the PDB-style file with coordinates for d5rnt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5rnt__:
- d5rnt__ first appeared (with stable ids) in SCOP 1.55
- d5rnt__ appears in SCOP 1.59
- d5rnt__ appears in the current release, SCOPe 2.08, called d5rnta_
View in 3D