Lineage for d6csga_ (6csg A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. Protein automated matches [190988] (49 species)
    not a true protein
  7. Species Enterovirus d68 [TaxId:42789] [269068] (15 PDB entries)
  8. Domain d6csga_: 6csg A: [361359]
    automated match to d4wm8a_

Details for d6csga_

PDB Entry: 6csg (more details), 2.17 Å

PDB Description: cryoem structure of human enterovirus d68 full native virion
PDB Compounds: (A:) viral protein 1

SCOPe Domain Sequences for d6csga_:

Sequence, based on SEQRES records: (download)

>d6csga_ b.121.4.0 (A:) automated matches {Enterovirus d68 [TaxId: 42789]}
iesiiktatdtvkseinaelgvvpslnavetgatsntepeeaiqtrtvinqhgvsetlve
nflsraalvskrsfeykdhtsstaradknffkwtintrsfvqlrrklelftylrfdaeit
ilttvavngsgnntyvglpdltlqamfvptgaltpekqdsfhwqsgsnasvffkisdppa
ritipfmcinsaysvfydgfagfeknglyginpadtignlcvrivnehqpvgftvtvrvy
mkpkhikawaprpprtlpymsiananykgkerapnalsaiignrdsvktmphnivn

Sequence, based on observed residues (ATOM records): (download)

>d6csga_ b.121.4.0 (A:) automated matches {Enterovirus d68 [TaxId: 42789]}
iesiiktatdtvkseinaelgvvpslnavetgatsntepeeaiqtrtvinqhgvsetlve
nflsraalvskrsfeykdhtsstadknffkwtintrsfvqlrrklelftylrfdaeitil
ttvavngyvglpdltlqamfvptgaltpekqdsfhwqsgsnasvffkisdpparitipfm
cinsaysvfydgfagfeknglyginpadtignlcvrivnehqpvgftvtvrvymkpkhik
awaprpprtlpymsiananykgkerapnalsaiignrdsvktmphnivn

SCOPe Domain Coordinates for d6csga_ are not available.

Timeline for d6csga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6csgb_