Lineage for d1trpa_ (1trp A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
single helix packs against antiparallel beta-sheetSuperfamily d.1.1: Microbial ribonucleases [53933] (4 families) 
Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins) 
Protein RNase T1 [53939] (2 species) Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries) 
Domain d1trpa_: 1trp A: [36134]
complexed with 2gp, ca; mutant
Details for d1trpa_
PDB Entry: 1trp (more details), 2.4 Å
PDB Description: x-ray crystallographic and calorimeric studies of the effects of the mutation trp 59 tyr in ribonuclease t1
PDB Compounds: (A:) ribonuclease t1 isozymeSCOPe Domain Sequences for d1trpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trpa_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnwegfdfsvsspyyeyp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOPe Domain Coordinates for d1trpa_:
Click to download the PDB-style file with coordinates for d1trpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trpa_:
- d1trpa_ first appeared (with stable ids) in SCOP 1.55
- d1trpa_ appears in SCOPe 2.07
View in 3D
