SCOPe 2.08: Domain d6a8ia1: 6a8i A:2-313

Lineage for d6a8ia1 (6a8i A:2-313)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein automated matches [191033] (3 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [361337] (2 PDB entries)

8. Domain d6a8ia1: 6a8i A:2-313 [361339]
   Other proteins in same PDB: d6a8ia2, d6a8ib2
   automated match to d1wl7a1
   complexed with ca; mutant

Details for d6a8ia1

PDB Entry: 6a8i, 1.9 Å

PDB Description: crystal structure of endo-arabinanase abn-ts d147n mutant in complex with arabinohexaose

PDB Compounds: (A:) Endo-alpha-(1->5)-L-arabinanase

SCOPe Domain Sequences for d6a8ia1:

Sequence; same for both SEQRES and ATOM records:

>d6a8ia1 b.67.2.1 (A:2-313) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
rdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpyl

Timeline for d6a8ia1:

• d6a8ia1 first appeared in SCOPe 2.07