SCOP 1.59: Domain d1ch0a_: 1ch0 A:

Lineage for d1ch0a_ (1ch0 A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)

8. Domain d1ch0a_: 1ch0 A: [36129]

Details for d1ch0a_

PDB Entry: 1ch0, 2.3 Å

PDB Description: rnase t1 variant with altered guanine binding segment

SCOP Domain Sequences for d1ch0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ch0a_ d.1.1.1 (A:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwqgfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1ch0a_:

• d1ch0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ch0a_ appears in SCOP 1.57
  
• d1ch0a_ appears in SCOP 1.61
  
• d1ch0a_ appears in the current release, SCOPe 2.08