SCOPe 2.08: Domain d6exre_: 6exr E:

Lineage for d6exre_ (6exr E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [361065] (1 PDB entry)

8. Domain d6exre_: 6exr E: [361267]
   automated match to d3a10a_

Details for d6exre_

PDB Entry: 6exr, 2.16 Å

PDB Description: chemotaxis protein chey from pyrococcus horikoshii

PDB Compounds: (E:) 120aa long hypothetical chemotaxis protein (CheY)

SCOPe Domain Sequences for d6exre_:

Sequence, based on SEQRES records:

>d6exre_ c.23.1.0 (E:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl

Sequence, based on observed residues (ATOM records):

>d6exre_ c.23.1.0 (E:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmmdgit
avkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl

Timeline for d6exre_:

• d6exre_ first appeared in SCOPe 2.07