SCOPe 2.07: Domain d5yxug2: 5yxu G:114-241

Lineage for d5yxug2 (5yxu G:114-241)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5yxug2: 5yxu G:114-241 [361256]
Other proteins in same PDB: d5yxua1, d5yxub1, d5yxuc1, d5yxuc2, d5yxue1, d5yxue2, d5yxue3, d5yxuf1, d5yxug1
automated match to d4grmd2

Details for d5yxug2

PDB Entry: 5yxu (more details), 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav

PDB Compounds: (G:) T cell receptor beta chain

SCOPe Domain Sequences for d5yxug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxug2 b.1.1.2 (G:114-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d5yxug2:

Click to download the PDB-style file with coordinates for d5yxug2.
(The format of our PDB-style files is described here.)

Timeline for d5yxug2: