Lineage for d5z9ma_ (5z9m A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. Protein automated matches [226867] (22 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [271298] (14 PDB entries)
  8. Domain d5z9ma_: 5z9m A: [361252]
    automated match to d4kqvb_
    protein/DNA complex; complexed with bz2, so4

Details for d5z9ma_

PDB Entry: 5z9m (more details), 2.74 Å

PDB Description: bacterial gyrb atpase domain in complex with a chemical fragment
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d5z9ma_:

Sequence, based on SEQRES records: (download)

>d5z9ma_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
rgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelviq
regkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrels
flnsgvsirlrdkrdgkedhfhyeg

Sequence, based on observed residues (ATOM records): (download)

>d5z9ma_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
rgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqap
lavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgke
dhfhyeg

SCOPe Domain Coordinates for d5z9ma_ are not available.

Timeline for d5z9ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5z9mb_