SCOPe 2.08: Domain d6gspa_: 6gsp A:

Lineage for d6gspa_ (6gsp A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d6gspa_: 6gsp A: [36125]
   complexed with 3gp, ca

Details for d6gspa_

PDB Entry: 6gsp, 2.2 Å

PDB Description: ribonuclease t1/3'-gmp, 15 weeks

PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d6gspa_:

Sequence; same for both SEQRES and ATOM records:

>d6gspa_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d6gspa_:

• d6gspa_ first appeared (with stable ids) in SCOP 1.55, called d6gsp__
  
• d6gspa_ appears in SCOPe 2.07