Lineage for d5w6bg_ (5w6b G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833602Protein automated matches [190258] (3 species)
    not a true protein
  7. 2833606Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)
  8. 2833644Domain d5w6bg_: 5w6b G: [361244]
    automated match to d1qw7a_
    complexed with cac, mpd, zn

Details for d5w6bg_

PDB Entry: 5w6b (more details), 1.74 Å

PDB Description: phosphotriesterase variant s1
PDB Compounds: (G:) Phosphotriesterase variant PTE-R1

SCOPe Domain Sequences for d5w6bg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w6bg_ c.1.9.3 (G:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvi
pflrekgipqetlagitvtnparflsptlr

SCOPe Domain Coordinates for d5w6bg_:

Click to download the PDB-style file with coordinates for d5w6bg_.
(The format of our PDB-style files is described here.)

Timeline for d5w6bg_: