Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
Protein HIV capsid protein, dimerisation domain [47359] (3 species) |
Species Human immunodeficiency virus 1 [TaxId:11676] [361175] (4 PDB entries) |
Domain d6n3ud_: 6n3u D: [361243] automated match to d5teob_ |
PDB Entry: 6n3u (more details), 2.9 Å
SCOPe Domain Sequences for d6n3ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n3ud_ a.28.3.1 (D:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqgvggpghkarvlaeamsqv
Timeline for d6n3ud_: