Lineage for d1rn1c_ (1rn1 C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (54 PDB entries) 
Domain d1rn1c_: 1rn1 C: [36124]
Details for d1rn1c_
PDB Entry: 1rn1 (more details), 1.84 Å
PDB Description: three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
SCOP Domain Sequences for d1rn1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rn1c_ d.1.1.1 (C:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d1rn1c_:
Click to download the PDB-style file with coordinates for d1rn1c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rn1c_:
- d1rn1c_ appears in SCOP 1.57
- d1rn1c_ appears in the current release, SCOPe 2.08
View in 3D
