![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins) |
![]() | Protein automated matches [196672] (8 species) not a true protein |
![]() | Species Paenibacillus barengoltzii [TaxId:1235795] [361209] (1 PDB entry) |
![]() | Domain d5yxtc_: 5yxt C: [361210] automated match to d2drsa_ |
PDB Entry: 5yxt (more details), 1.88 Å
SCOPe Domain Sequences for d5yxtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yxtc_ a.102.1.2 (C:) automated matches {Paenibacillus barengoltzii [TaxId: 1235795]} mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc lylfallalsgnyriwmpr
Timeline for d5yxtc_: