Lineage for d5yxtc_ (5yxt C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722149Protein automated matches [196672] (8 species)
    not a true protein
  7. 2722180Species Paenibacillus barengoltzii [TaxId:1235795] [361209] (1 PDB entry)
  8. 2722183Domain d5yxtc_: 5yxt C: [361210]
    automated match to d2drsa_

Details for d5yxtc_

PDB Entry: 5yxt (more details), 1.88 Å

PDB Description: crystal structure of reducing end xylose-releasing exo-oligoxylanase
PDB Compounds: (C:) Reducing end xylose-releasing exo-oligoxylanase

SCOPe Domain Sequences for d5yxtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxtc_ a.102.1.2 (C:) automated matches {Paenibacillus barengoltzii [TaxId: 1235795]}
mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
lylfallalsgnyriwmpr

SCOPe Domain Coordinates for d5yxtc_:

Click to download the PDB-style file with coordinates for d5yxtc_.
(The format of our PDB-style files is described here.)

Timeline for d5yxtc_: