Lineage for d6ii1a_ (6ii1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688623Species Cow (Bos taurus) [TaxId:9913] [361141] (1 PDB entry)
  8. 2688624Domain d6ii1a_: 6ii1 A: [361208]
    Other proteins in same PDB: d6ii1b_, d6ii1d_
    automated match to d2qssa_
    complexed with cmo, hem

Details for d6ii1a_

PDB Entry: 6ii1 (more details), 1.34 Å

PDB Description: crystal structure analysis of co form hemoglobin from bos taurus
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d6ii1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ii1a_ a.1.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghgak
vaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpav
hasldkflanvstvlts

SCOPe Domain Coordinates for d6ii1a_:

Click to download the PDB-style file with coordinates for d6ii1a_.
(The format of our PDB-style files is described here.)

Timeline for d6ii1a_: