Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Nepeta racemosa [TaxId:213401] [361088] (1 PDB entry) |
Domain d6f9qa_: 6f9q A: [361197] automated match to d1ybva_ complexed with cl, nad |
PDB Entry: 6f9q (more details), 1.4 Å
SCOPe Domain Sequences for d6f9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f9qa_ c.2.1.0 (A:) automated matches {Nepeta racemosa [TaxId: 213401]} kkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsfvq cdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrgaa vcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgahsi rvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdeaaf vtghdlpvdggvlcmpf
Timeline for d6f9qa_: