SCOPe 2.07: Domain d6imfa1: 6imf A:2-164

Lineage for d6imfa1 (6imf A:2-164)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (4 species)
   not a true protein

7. Species Protobothrops flavoviridis [TaxId:88087] [361185] (1 PDB entry)

8. Domain d6imfa1: 6imf A:2-164 [361186]
   Other proteins in same PDB: d6imfa2
   automated match to d1wvra1
   complexed with gol, mes

Details for d6imfa1

PDB Entry: 6imf, 2.3 Å

PDB Description: crystal structure of toxin/antitoxin complex

PDB Compounds: (A:) Cysteine-rich venom protein triflin

SCOPe Domain Sequences for d6imfa1:

Sequence; same for both SEQRES and ATOM records:

>d6imfa1 d.111.1.1 (A:2-164) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
vdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrcieshs
srdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqivw
yksyragcaaaycpsskysyfyvcqycpagniigktatpyksg

Timeline for d6imfa1:

• d6imfa1 is new in SCOPe 2.07-stable
  
• d6imfa1 appears in the current release, SCOPe 2.08