Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
Superfamily d.111.1: PR-1-like [55797] (2 families) |
Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
Protein automated matches [194852] (4 species) not a true protein |
Species Protobothrops flavoviridis [TaxId:88087] [361185] (1 PDB entry) |
Domain d6imfa1: 6imf A:2-164 [361186] Other proteins in same PDB: d6imfa2 automated match to d1wvra1 complexed with gol, mes |
PDB Entry: 6imf (more details), 2.3 Å
SCOPe Domain Sequences for d6imfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6imfa1 d.111.1.1 (A:2-164) automated matches {Protobothrops flavoviridis [TaxId: 88087]} vdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrcieshs srdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqivw yksyragcaaaycpsskysyfyvcqycpagniigktatpyksg
Timeline for d6imfa1: