Lineage for d6ii1b_ (6ii1 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687041Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)
  8. 2687042Domain d6ii1b_: 6ii1 B: [361160]
    Other proteins in same PDB: d6ii1a_, d6ii1c_
    automated match to d1g08b_
    complexed with cmo, hem

Details for d6ii1b_

PDB Entry: 6ii1 (more details), 1.34 Å

PDB Description: crystal structure analysis of co form hemoglobin from bos taurus
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d6ii1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ii1b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
ltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvka
hgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgkef
tpvlqadfqkvvagvanalahry

SCOPe Domain Coordinates for d6ii1b_:

Click to download the PDB-style file with coordinates for d6ii1b_.
(The format of our PDB-style files is described here.)

Timeline for d6ii1b_: