Lineage for d1b2mb_ (1b2m B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. Protein RNase T1 [53939] (2 species)
  7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. Domain d1b2mb_: 1b2m B: [36116]
    protein/RNA complex

Details for d1b2mb_

PDB Entry: 1b2m (more details), 2 Å

PDB Description: three-dimensional structure of ribonulcease t1 complexed with an isosteric phosphonate analogue of gpu: alternate substrate binding modes and catalysis.
PDB Compounds: (B:) ribonuclease t1

SCOPe Domain Sequences for d1b2mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2mb_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d1b2mb_ are not available.

Timeline for d1b2mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b2ma_