Lineage for d6h07b_ (6h07 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842721Protein R-specific alcohol dehydrogenase [89521] (1 species)
  7. 2842722Species Lactobacillus brevis [TaxId:1580] [89522] (11 PDB entries)
  8. 2842734Domain d6h07b_: 6h07 B: [361159]
    automated match to d1nxqa_
    complexed with mg, mn

Details for d6h07b_

PDB Entry: 6h07 (more details), 1.48 Å

PDB Description: x-ray structure of lactobacillus brevis alcohol dehydrogenase
PDB Compounds: (B:) R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d6h07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h07b_ c.2.1.2 (B:) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOPe Domain Coordinates for d6h07b_:

Click to download the PDB-style file with coordinates for d6h07b_.
(The format of our PDB-style files is described here.)

Timeline for d6h07b_: