Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein R-specific alcohol dehydrogenase [89521] (1 species) |
Species Lactobacillus brevis [TaxId:1580] [89522] (11 PDB entries) |
Domain d6h07b_: 6h07 B: [361159] automated match to d1nxqa_ complexed with mg, mn |
PDB Entry: 6h07 (more details), 1.48 Å
SCOPe Domain Sequences for d6h07b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h07b_ c.2.1.2 (B:) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs efvvdggytaq
Timeline for d6h07b_: