Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries) |
Domain d6ii1d_: 6ii1 D: [361155] Other proteins in same PDB: d6ii1a_, d6ii1c_ automated match to d1g08b_ complexed with cmo, hem |
PDB Entry: 6ii1 (more details), 1.34 Å
SCOPe Domain Sequences for d6ii1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ii1d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]} mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke ftpvlqadfqkvvagvanalahryh
Timeline for d6ii1d_: