Lineage for d6ihxc_ (6ihx C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686276Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries)
  8. 2686282Domain d6ihxc_: 6ihx C: [361143]
    Other proteins in same PDB: d6ihxb_, d6ihxd_
    automated match to d2qssa_
    complexed with cmo, hem

Details for d6ihxc_

PDB Entry: 6ihx (more details), 1.46 Å

PDB Description: crystal structure analysis of bovine hemoglobin modified by snp
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d6ihxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ihxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltsky

SCOPe Domain Coordinates for d6ihxc_:

Click to download the PDB-style file with coordinates for d6ihxc_.
(The format of our PDB-style files is described here.)

Timeline for d6ihxc_: