Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries) |
Domain d6ihxc_: 6ihx C: [361143] Other proteins in same PDB: d6ihxb_, d6ihxd_ automated match to d2qssa_ complexed with cmo, hem |
PDB Entry: 6ihx (more details), 1.46 Å
SCOPe Domain Sequences for d6ihxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ihxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvltsky
Timeline for d6ihxc_: