![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [361141] (1 PDB entry) |
![]() | Domain d6ii1c_: 6ii1 C: [361142] Other proteins in same PDB: d6ii1b_, d6ii1d_ automated match to d2qssa_ complexed with cmo, hem |
PDB Entry: 6ii1 (more details), 1.34 Å
SCOPe Domain Sequences for d6ii1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ii1c_ a.1.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvlts
Timeline for d6ii1c_: