SCOP 1.59: Domain d2bu4a_: 2bu4 A:

Lineage for d2bu4a_ (2bu4 A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)

8. Domain d2bu4a_: 2bu4 A: [36114]

Details for d2bu4a_

PDB Entry: 2bu4, 1.95 Å

PDB Description: ribonuclease t1 complex with 2'gmp

SCOP Domain Sequences for d2bu4a_:

Sequence; same for both SEQRES and ATOM records:

>d2bu4a_ d.1.1.1 (A:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d2bu4a_:

• d2bu4a_ first appeared (with stable ids) in SCOP 1.55
  
• d2bu4a_ appears in SCOP 1.57
  
• d2bu4a_ appears in SCOP 1.61
  
• d2bu4a_ appears in the current release, SCOPe 2.08